PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma74g01010.1
Common NameZOSMA_74G01010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family TALE
Protein Properties Length: 417aa    MW: 46646.4 Da    PI: 7.1534
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma74g01010.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.56.3e-102723091954
                      HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
         Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                      Fe   ++yp+ +++  LAk++gL+ +qV++WF N R +
  Zosma74g01010.1 272 FEHflHPYPTDSDKHMLAKQTGLSRNQVSNWFINARVR 309
                      664459******************************88 PP

2BELL90.81.4e-29157223672
             BELL   6 qkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                       + k++L+s+l+eV+k+Ykqyv+q++ v++sFe+vagl++a+pYt l    +++hFrcLkdaiaeq+
  Zosma74g01010.1 157 GRVKSRLISMLDEVYKKYKQYVQQVEYVMASFETVAGLDHAAPYTCLVISLMTKHFRCLKDAIAEQL 223
                      56699************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.1E-3698221IPR006563POX domain
PfamPF075265.0E-30103220IPR006563POX domain
SMARTSM003894.8E-10253317IPR001356Homeobox domain
CDDcd000861.38E-12253313No hitNo description
SuperFamilySSF466895.56E-17255319IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.1E-27256317IPR009057Homeodomain-like
PfamPF059204.3E-19270309IPR008422Homeobox KN domain
PROSITE profilePS5007112.001272313IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010089Biological Processxylem development
GO:0010154Biological Processfruit development
GO:0010223Biological Processsecondary shoot formation
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048457Biological Processfloral whorl morphogenesis
GO:0048645Biological Processorgan formation
GO:0080006Biological Processinternode patterning
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 417 aa     Download sequence    Send to blast
MEEEAGDHQT TTKTTTQQHH IFPFYHHVPQ QSKREKLRYS TTPQPEIDLS PPHHPPSTST  60
NNPRILMSSS SSLSLPTFPH RRGSAVSLTL SSSTEPFTGY ASVLKTSRFL RPTQQMLDEI  120
CSVGGVVGFL NGSDSTEFGL HDSQNLNGDG SSGGETGRVK SRLISMLDEV YKKYKQYVQQ  180
VEYVMASFET VAGLDHAAPY TCLVISLMTK HFRCLKDAIA EQLRFANKQN TPVPLFGEHS  240
KASSGANEQV NIWRPQRGLP DCAVSVLKAW LFEHFLHPYP TDSDKHMLAK QTGLSRNQVS  300
NWFINARVRL WKPLVEEIHT LEMRQAQTTR PECVKTVEEE AQEGQPPCKR FREKEVEESS  360
EVPNNRGGGI SLTLGLHQNN GVPLNLARRF GLDDSTNIGG GFEKDMDEQM LRHFVG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrm_B2e-15259317563Homeobox protein Meis2
4xrm_A2e-15259317563Homeobox protein Meis2
3k2a_B2e-15259317563Homeobox protein Meis2
3k2a_A2e-15259317563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010654234.11e-102PREDICTED: BEL1-like homeodomain protein 9
SwissprotQ9LZM89e-79BLH9_ARATH; BEL1-like homeodomain protein 9
TrEMBLA0A0K9NRQ80.0A0A0K9NRQ8_Z
STRINGVIT_08s0007g01290.t011e-101(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25283881
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02030.16e-69TALE family protein